PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678368589
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 405aa    MW: 44780.7 Da    PI: 8.0882
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678368589genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.41.2e-083193571854
                HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  678368589 319 MFQNflHPYPKDAEKHLLALKSGLTRSQVSNWFINARVR 357
                6887789******************************88 PP

2BELL667.4e-22200265672
       BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                + kk +Ll ll+ Vd++Y+q+ ++++tvis+F+av++l++ ++++++Al +iS  +++L+ +i+++i
  678368589 200 ETKKKHLLGLLQLVDEQYNQCLDEIHTVISAFHAVTDLDP-NLHARFALPRISIMYKNLRGRISSHI 265
                68**************************************.***********************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-11140263IPR006563POX domain
PfamPF075263.3E-18147262IPR006563POX domain
PROSITE profilePS5007111.029298361IPR001356Homeobox domain
CDDcd000866.84E-12301362No hitNo description
SMARTSM003897.4E-6301365IPR001356Homeobox domain
SuperFamilySSF466897.7E-16304370IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-26304367IPR009057Homeodomain-like
PfamPF059201.2E-14318357IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MDMQTEAAAP LSYVLTETAS VYPADSLVQN SNQYHLQPSL FSSSLHEAFA GFSSDPRVSV  60
PGAPFSSDTY ECPRSIVGTS GVYGGFLPIE TACGNKFMSP QGGGGNTSQN EWLMNAASNH  120
LTSRFNNGLS LSLAANPSFI KPSKPFLGSA AFLHVMQEIL AEIASFALDH NICCSSEENR  180
VAANSIGGFS DQTRPFLGAE TKKKHLLGLL QLVDEQYNQC LDEIHTVISA FHAVTDLDPN  240
LHARFALPRI SIMYKNLRGR ISSHILAMGS DPKEGEVDSK CLIEKQWSLQ QLKKKDQHQL  300
WKPQRGLPEQ SVSVLKAWMF QNFLHPYPKD AEKHLLALKS GLTRSQVSNW FINARVRLWK  360
PMIEEMYAET NRRKSSSSSC RSIKNNQESS AALKTSSSIP TSPFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-14307365563Homeobox protein Meis2
3k2a_B2e-14307365563Homeobox protein Meis2
4xrs_A2e-14307364158Homeobox protein Meis1
4xrs_B2e-14307364158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096935.11e-110PREDICTED: homeobox protein ATH1 isoform X2
SwissprotP487313e-87ATH1_ARATH; Homeobox protein ATH1
TrEMBLS8CT001e-110S8CT00_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc08g065420.2.14e-97(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.13e-77homeobox gene 1